PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 475994
Common NameARALYDRAFT_475994
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 354aa    MW: 39256 Da    PI: 7.7664
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
475994genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65e-32214269156
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
              k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
   475994 214 KQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 269
              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.61E-17211272IPR009057Homeodomain-like
PROSITE profilePS5129414.821211271IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-28212272IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-27214269IPR006447Myb domain, plants
PfamPF002495.6E-8216267IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MVEMDYAKKM QKCHEYVEAL EEEQKKIQVF QRELPLCLEL VTQAIEACRK ELSGTTTTSE  60
QCSEQTTSVC GGPVFEEFIP IKKRSLCEEQ EEDGEHESSP ELEQIGNNKK SDWLRSVQLW  120
TPSPDLNPKE ERVVKKAKVV EVKPKSGAFQ PFQKEKKRVL ETDLQPAVKV ASSTPATTTS  180
STTETGGAKS ELVKVGEEQR QIEQQQSQSQ THRKQRRCWS PELHRRFLNA LQQLGGSHVA  240
TPKQIRDHMK VDGLTNDEVK SHLQKYRLHT RRPAATSVAA QSNGNPQQPQ FVVVGGIWVP  300
SPQDFPPPSD VANNGGVYAP VAVAQSPKRS VERSCNSPAA SSSTNTNTST PVS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0638860.0AY063886.1 Arabidopsis thaliana unknown protein (At1g68670) mRNA, complete cds.
GenBankAY0912410.0AY091241.1 Arabidopsis thaliana unknown protein (At1g68670) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002887197.10.0hypothetical protein ARALYDRAFT_475994
TrEMBLD7KWE90.0D7KWE9_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.2__1124__AT1G68670.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-153G2-like family protein